Placeholder image of a protein
Icon representing a puzzle

585: CASP10 Target T0722

Closed since almost 14 years ago

Advanced Overall Prediction

Summary


Created
June 25, 2012
Expires
Max points
100
Description

The eleventh CASP10 target is not an easy one. It's 152 residues and none of the alignment programs were able to find good templates for this target. It might be the case that this protein has no homologs. We are giving you 6 templates (in hope that one of them is correct) for now, and will provide you with some server predictions once they are released. More details about this CASP target are in the puzzle comments.

Top groups


  1. Avatar for Team Commonwealth 31. Team Commonwealth 1 pt. 4,172
  2. Avatar for Deleted group 32. Deleted group pts. 4,172

  1. Avatar for jakbinimbol 31. jakbinimbol Lv 1 60 pts. 11,209
  2. Avatar for doug.ehlert 32. doug.ehlert Lv 1 59 pts. 11,206
  3. Avatar for Deleted player 33. Deleted player pts. 11,205
  4. Avatar for krulon 34. krulon Lv 1 57 pts. 11,205
  5. Avatar for tokens 35. tokens Lv 1 56 pts. 11,191
  6. Avatar for johnmitch 36. johnmitch Lv 1 55 pts. 11,186
  7. Avatar for BootsMcGraw 37. BootsMcGraw Lv 1 54 pts. 11,184
  8. Avatar for tallguy-13088 38. tallguy-13088 Lv 1 53 pts. 11,183
  9. Avatar for spmm 39. spmm Lv 1 52 pts. 11,159
  10. Avatar for christioanchauvin 40. christioanchauvin Lv 1 51 pts. 11,155

Comments


beta_helix Staff Lv 1

Here is the CASP link for this target (showing the amino acid sequence):
http://predictioncenter.org/casp10/target.cgi?id=137
__________________

Here is the sequence logo predicted by the SAM server.

H = helix
E = sheet
C = loop (or coil)

The taller the letter at each position, the higher the probability of that specific secondary structure for that amino acid.

For example, the Leucines at residues 27, 31, 34, 60-61, 73, 82-84, 91-95, 101, 105, 116, 123, 130 & 140 are highly predicted to be in a helix. However, the Leucines at residues 14, 22-23, 150 & 152 are predicted to be anything.
__________________

Link to template PDBs:

http://www.pdb.org/pdb/explore/explore.do?structureId=1gqe
http://www.pdb.org/pdb/explore/explore.do?structureId=1ls4
http://www.pdb.org/pdb/explore/explore.do?structureId=3tul
http://www.pdb.org/pdb/explore/explore.do?structureId=3k29
http://www.pdb.org/pdb/explore/explore.do?structureId=1ya9
http://www.pdb.org/pdb/explore/explore.do?structureId=3lg7

infjamc Lv 1

What's going on with the sequence at the N-terminus? (Is it an added polyhistidine tag, or was it a part of the "natural" sequence?)

beta_helix Staff Lv 1

In fact, the RosettaServer only modeled this sequence:
SSGRENLYFQGAGPLLTEELIKALQDLENAASGDATVRQKIASLPQEVQDVSLL
EKITDKEAAERLSKTVDEACLLLAEYNGRLAAELEDRRQLARMLVEYTQNQKDV
LSEKEKKLEEYKQKLARVTQVRKELKSHIQSLPDLSL

Although we can't be 100% sure since the CASP10 organizers did not give us any additional information about it. We'll have to see what all the servers did with the first 7 residues.