Placeholder image of a protein
Icon representing a puzzle

585: CASP10 Target T0722

Closed since over 13 years ago

Advanced Overall Prediction

Summary


Created
June 25, 2012
Expires
Max points
100
Description

The eleventh CASP10 target is not an easy one. It's 152 residues and none of the alignment programs were able to find good templates for this target. It might be the case that this protein has no homologs. We are giving you 6 templates (in hope that one of them is correct) for now, and will provide you with some server predictions once they are released. More details about this CASP target are in the puzzle comments.

Top groups


  1. Avatar for Contenders 100 pts. 11,578
  2. Avatar for foldeRNA 2. foldeRNA 85 pts. 11,528
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 72 pts. 11,480
  4. Avatar for Go Science 4. Go Science 61 pts. 11,425
  5. Avatar for Beta Folders 5. Beta Folders 51 pts. 11,374
  6. Avatar for Void Crushers 6. Void Crushers 42 pts. 11,348
  7. Avatar for Gargleblasters 7. Gargleblasters 35 pts. 11,306
  8. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 23 pts. 11,155
  9. Avatar for Androids 10. Androids 19 pts. 11,122

  1. Avatar for JiminP 211. JiminP Lv 1 1 pt. 8,107
  2. Avatar for Mr.orange 212. Mr.orange Lv 1 1 pt. 8,052
  3. Avatar for heyubob 213. heyubob Lv 1 1 pt. 7,989
  4. Avatar for matteline 214. matteline Lv 1 1 pt. 7,957
  5. Avatar for Mohock 215. Mohock Lv 1 1 pt. 7,912
  6. Avatar for repasa 216. repasa Lv 1 1 pt. 7,871
  7. Avatar for Uganalandia 217. Uganalandia Lv 1 1 pt. 7,855
  8. Avatar for nwood1990 218. nwood1990 Lv 1 1 pt. 7,845
  9. Avatar for tonytony9 219. tonytony9 Lv 1 1 pt. 7,809
  10. Avatar for PTEver 220. PTEver Lv 1 1 pt. 7,778

Comments


beta_helix Staff Lv 1

Here is the CASP link for this target (showing the amino acid sequence):
http://predictioncenter.org/casp10/target.cgi?id=137
__________________

Here is the sequence logo predicted by the SAM server.

H = helix
E = sheet
C = loop (or coil)

The taller the letter at each position, the higher the probability of that specific secondary structure for that amino acid.

For example, the Leucines at residues 27, 31, 34, 60-61, 73, 82-84, 91-95, 101, 105, 116, 123, 130 & 140 are highly predicted to be in a helix. However, the Leucines at residues 14, 22-23, 150 & 152 are predicted to be anything.
__________________

Link to template PDBs:

http://www.pdb.org/pdb/explore/explore.do?structureId=1gqe
http://www.pdb.org/pdb/explore/explore.do?structureId=1ls4
http://www.pdb.org/pdb/explore/explore.do?structureId=3tul
http://www.pdb.org/pdb/explore/explore.do?structureId=3k29
http://www.pdb.org/pdb/explore/explore.do?structureId=1ya9
http://www.pdb.org/pdb/explore/explore.do?structureId=3lg7

infjamc Lv 1

What's going on with the sequence at the N-terminus? (Is it an added polyhistidine tag, or was it a part of the "natural" sequence?)

beta_helix Staff Lv 1

In fact, the RosettaServer only modeled this sequence:
SSGRENLYFQGAGPLLTEELIKALQDLENAASGDATVRQKIASLPQEVQDVSLL
EKITDKEAAERLSKTVDEACLLLAEYNGRLAAELEDRRQLARMLVEYTQNQKDV
LSEKEKKLEEYKQKLARVTQVRKELKSHIQSLPDLSL

Although we can't be 100% sure since the CASP10 organizers did not give us any additional information about it. We'll have to see what all the servers did with the first 7 residues.