Placeholder image of a protein
Icon representing a puzzle

782: De-novo Freestyle 30: Hand-folding Round

Closed since over 12 years ago

Intermediate Overall Prediction Hand-Folding

Summary

Created
September 20, 2013
Expires
Max points
100
Description

We are giving you another currently unsolved protein as an extended chain. This round only GUI scripts are allowed and sharing has been disabled. After this puzzle expires, the puzzle will be re-posted and LUA scripts and sharing will be allowed. You'll be able to load in your solutions from this puzzle and use scripting and sharing.

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 9 pts. 9,756
  2. Avatar for Natural Abilities 12. Natural Abilities 7 pts. 9,666
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 5 pts. 9,530
  4. Avatar for Richard Dawkins Foundation 14. Richard Dawkins Foundation 4 pts. 9,509
  5. Avatar for SETI.Germany 15. SETI.Germany 3 pts. 9,490
  6. Avatar for Repro-men 16. Repro-men 2 pts. 9,408
  7. Avatar for Team Schleswig-Holstein 17. Team Schleswig-Holstein 1 pt. 9,329
  8. Avatar for Curtin Crowd 18. Curtin Crowd 1 pt. 9,141
  9. Avatar for Deleted group 19. Deleted group pts. 9,067
  10. Avatar for Crunching Family 20. Crunching Family 1 pt. 8,938
  1. Avatar for Mark-
    1. Mark- Lv 1
    100 pts. 10,234
  2. Avatar for Steven Pletsch 2. Steven Pletsch Lv 1 99 pts. 10,202
  3. Avatar for Wilm 3. Wilm Lv 1 97 pts. 10,056
  4. Avatar for Timo van der Laan 4. Timo van der Laan Lv 1 95 pts. 10,012
  5. Avatar for Galaxie 5. Galaxie Lv 1 93 pts. 10,005
  6. Avatar for MurloW 6. MurloW Lv 1 91 pts. 9,955
  7. Avatar for drumpeter18yrs9yrs 7. drumpeter18yrs9yrs Lv 1 89 pts. 9,950
  8. Avatar for bertro 8. bertro Lv 1 87 pts. 9,930
  9. Avatar for tokens 9. tokens Lv 1 85 pts. 9,926
  10. Avatar for grogar7 10. grogar7 Lv 1 84 pts. 9,900

Comments

bkoep Staff Lv 1

We're still waiting on the secondary structure predictions for this protein. Check back later for updates!

bkoep Staff Lv 1

SPILPKAENVDSICIDFTNSIQKIYDDSESIQKILSEIATGKRTEKQSIQDYPSAEEYGTINIENNGGMTTMFYYEENGKYYIECPYKGIYEIENNFEDMI

bkoep Staff Lv 1

Here is the sequence logo predicted by the SAM server:

H = helix
E = sheet
C = loop (or coil)

The taller the letter at each position, the higher the probability of that specific secondary structure for that amino acid.

For example, the Isoleucines at residues 13 and 25 are highly predicted to be part of a sheet. However, the Isoleucines at residues 31 and 38 are predicted to be part of a helix!