Placeholder image of a protein
Icon representing a puzzle

782: De-novo Freestyle 30: Hand-folding Round

Closed since over 12 years ago

Intermediate Overall Prediction Hand-Folding

Summary


Created
September 20, 2013
Expires
Max points
100
Description

We are giving you another currently unsolved protein as an extended chain. This round only GUI scripts are allowed and sharing has been disabled. After this puzzle expires, the puzzle will be re-posted and LUA scripts and sharing will be allowed. You'll be able to load in your solutions from this puzzle and use scripting and sharing.

Top groups


  1. Avatar for Freedom Folders 21. Freedom Folders 1 pt. 8,796
  2. Avatar for Team Canada 22. Team Canada 1 pt. 8,699
  3. Avatar for DSN @ Home 24. DSN @ Home 1 pt. 7,668
  4. Avatar for Deleted group 25. Deleted group pts. 7,607
  5. Avatar for Brony@Home 26. Brony@Home 1 pt. 0

  1. Avatar for Marian90 121. Marian90 Lv 1 4 pts. 9,064
  2. Avatar for cobaltteal 122. cobaltteal Lv 1 4 pts. 9,056
  3. Avatar for Tyggy Too 123. Tyggy Too Lv 1 4 pts. 9,045
  4. Avatar for MaartenDesnouck 124. MaartenDesnouck Lv 1 4 pts. 9,043
  5. Avatar for justjustin 125. justjustin Lv 1 4 pts. 9,042
  6. Avatar for gloverd 126. gloverd Lv 1 4 pts. 9,030
  7. Avatar for Anfinsen_slept_here 127. Anfinsen_slept_here Lv 1 4 pts. 9,018
  8. Avatar for Crossed Sticks 128. Crossed Sticks Lv 1 3 pts. 9,008
  9. Avatar for parsnip 129. parsnip Lv 1 3 pts. 9,006
  10. Avatar for Tac1 130. Tac1 Lv 1 3 pts. 8,999

Comments


bkoep Staff Lv 1

We're still waiting on the secondary structure predictions for this protein. Check back later for updates!

bkoep Staff Lv 1

SPILPKAENVDSICIDFTNSIQKIYDDSESIQKILSEIATGKRTEKQSIQDYPSAEEYGTINIENNGGMTTMFYYEENGKYYIECPYKGIYEIENNFEDMI

bkoep Staff Lv 1

Here is the sequence logo predicted by the SAM server:

H = helix
E = sheet
C = loop (or coil)

The taller the letter at each position, the higher the probability of that specific secondary structure for that amino acid.

For example, the Isoleucines at residues 13 and 25 are highly predicted to be part of a sheet. However, the Isoleucines at residues 31 and 38 are predicted to be part of a helix!