Placeholder image of a protein
Icon representing a puzzle

782: De-novo Freestyle 30: Hand-folding Round

Closed since over 12 years ago

Intermediate Overall Prediction Hand-Folding

Summary


Created
September 20, 2013
Expires
Max points
100
Description

We are giving you another currently unsolved protein as an extended chain. This round only GUI scripts are allowed and sharing has been disabled. After this puzzle expires, the puzzle will be re-posted and LUA scripts and sharing will be allowed. You'll be able to load in your solutions from this puzzle and use scripting and sharing.

Top groups


  1. Avatar for Freedom Folders 21. Freedom Folders 1 pt. 8,796
  2. Avatar for Team Canada 22. Team Canada 1 pt. 8,699
  3. Avatar for DSN @ Home 24. DSN @ Home 1 pt. 7,668
  4. Avatar for Deleted group 25. Deleted group pts. 7,607
  5. Avatar for Brony@Home 26. Brony@Home 1 pt. 0

  1. Avatar for Deus_Tempestas 161. Deus_Tempestas Lv 1 1 pt. 8,699
  2. Avatar for callmeAKA 162. callmeAKA Lv 1 1 pt. 8,697
  3. Avatar for RichPark 163. RichPark Lv 1 1 pt. 8,679
  4. Avatar for MSLOVELYLADE 164. MSLOVELYLADE Lv 1 1 pt. 8,669
  5. Avatar for Ch Garnier 165. Ch Garnier Lv 1 1 pt. 8,663
  6. Avatar for Tump 166. Tump Lv 1 1 pt. 8,645
  7. Avatar for david10208 167. david10208 Lv 1 1 pt. 8,625
  8. Avatar for Rachel_Pruett 168. Rachel_Pruett Lv 1 1 pt. 8,604
  9. Avatar for Elias Bittar 169. Elias Bittar Lv 1 1 pt. 8,591
  10. Avatar for brgreening 170. brgreening Lv 1 1 pt. 8,580

Comments


bkoep Staff Lv 1

We're still waiting on the secondary structure predictions for this protein. Check back later for updates!

bkoep Staff Lv 1

SPILPKAENVDSICIDFTNSIQKIYDDSESIQKILSEIATGKRTEKQSIQDYPSAEEYGTINIENNGGMTTMFYYEENGKYYIECPYKGIYEIENNFEDMI

bkoep Staff Lv 1

Here is the sequence logo predicted by the SAM server:

H = helix
E = sheet
C = loop (or coil)

The taller the letter at each position, the higher the probability of that specific secondary structure for that amino acid.

For example, the Isoleucines at residues 13 and 25 are highly predicted to be part of a sheet. However, the Isoleucines at residues 31 and 38 are predicted to be part of a helix!