Placeholder image of a protein
Icon representing a puzzle

782: De-novo Freestyle 30: Hand-folding Round

Closed since over 12 years ago

Intermediate Intermediate Overall Overall Prediction Prediction Hand-Folding Hand-Folding

Summary

Created
September 20, 2013
Expires
Max points
100
Description

We are giving you another currently unsolved protein as an extended chain. This round only GUI scripts are allowed and sharing has been disabled. After this puzzle expires, the puzzle will be re-posted and LUA scripts and sharing will be allowed. You'll be able to load in your solutions from this puzzle and use scripting and sharing.

Top groups

  1. Avatar for Freedom Folders 21. Freedom Folders 1 pt. 8,796
  2. Avatar for Team Canada 22. Team Canada 1 pt. 8,699
  3. Avatar for Cell Biology Smith Fall 2013 23. Cell Biology Smith Fall 2013 1 pt. 8,544
  4. Avatar for DSN @ Home 24. DSN @ Home 1 pt. 7,668
  5. Avatar for Deleted group 25. Deleted group pts. 7,607
  6. Avatar for Brony@Home 26. Brony@Home 1 pt. 0
  7. Avatar for Rice Biochemistry 27. Rice Biochemistry 1 pt. 0
  1. Avatar for doenjon 191. doenjon Lv 1 1 pt. 8,258
  2. Avatar for jsorr 192. jsorr Lv 1 1 pt. 8,250
  3. Avatar for crawlee34225 193. crawlee34225 Lv 1 1 pt. 8,234
  4. Avatar for Hui Zhen 194. Hui Zhen Lv 1 1 pt. 8,201
  5. Avatar for saksoft2 195. saksoft2 Lv 1 1 pt. 8,201
  6. Avatar for nicksf21 196. nicksf21 Lv 1 1 pt. 8,171
  7. Avatar for DrMistry 197. DrMistry Lv 1 1 pt. 8,164
  8. Avatar for funini 198. funini Lv 1 1 pt. 8,162
  9. Avatar for anne romaine 199. anne romaine Lv 1 1 pt. 8,149
  10. Avatar for barbaranne 200. barbaranne Lv 1 1 pt. 8,100

Comments

bkoep Staff Lv 1

We're still waiting on the secondary structure predictions for this protein. Check back later for updates!

bkoep Staff Lv 1

SPILPKAENVDSICIDFTNSIQKIYDDSESIQKILSEIATGKRTEKQSIQDYPSAEEYGTINIENNGGMTTMFYYEENGKYYIECPYKGIYEIENNFEDMI

bkoep Staff Lv 1

Here is the sequence logo predicted by the SAM server:

H = helix
E = sheet
C = loop (or coil)

The taller the letter at each position, the higher the probability of that specific secondary structure for that amino acid.

For example, the Isoleucines at residues 13 and 25 are highly predicted to be part of a sheet. However, the Isoleucines at residues 31 and 38 are predicted to be part of a helix!