Placeholder image of a protein
Icon representing a puzzle

782: De-novo Freestyle 30: Hand-folding Round

Closed since over 12 years ago

Intermediate Overall Prediction Hand-Folding

Summary

Created
September 20, 2013
Expires
Max points
100
Description

We are giving you another currently unsolved protein as an extended chain. This round only GUI scripts are allowed and sharing has been disabled. After this puzzle expires, the puzzle will be re-posted and LUA scripts and sharing will be allowed. You'll be able to load in your solutions from this puzzle and use scripting and sharing.

Top groups

  1. Avatar for Freedom Folders 21. Freedom Folders 1 pt. 8,796
  2. Avatar for Team Canada 22. Team Canada 1 pt. 8,699
  3. Avatar for Cell Biology Smith Fall 2013 23. Cell Biology Smith Fall 2013 1 pt. 8,544
  4. Avatar for DSN @ Home 24. DSN @ Home 1 pt. 7,668
  5. Avatar for Deleted group 25. Deleted group pts. 7,607
  6. Avatar for Brony@Home 26. Brony@Home 1 pt. 0
  7. Avatar for Rice Biochemistry 27. Rice Biochemistry 1 pt. 0
  1. Avatar for Punzie 41. Punzie Lv 1 42 pts. 9,587
  2. Avatar for stomjoh 42. stomjoh Lv 1 41 pts. 9,571
  3. Avatar for Bletchley Park 43. Bletchley Park Lv 1 40 pts. 9,571
  4. Avatar for johnmitch 44. johnmitch Lv 1 39 pts. 9,558
  5. Avatar for Deleted player 45. Deleted player pts. 9,556
  6. Avatar for TheGUmmer 46. TheGUmmer Lv 1 38 pts. 9,554
  7. Avatar for Vredeman 47. Vredeman Lv 1 37 pts. 9,545
  8. Avatar for smilingone 48. smilingone Lv 1 36 pts. 9,543
  9. Avatar for dnpw1 49. dnpw1 Lv 1 35 pts. 9,539
  10. Avatar for ViJay7019 50. ViJay7019 Lv 1 34 pts. 9,530

Comments

bkoep Staff Lv 1

We're still waiting on the secondary structure predictions for this protein. Check back later for updates!

bkoep Staff Lv 1

SPILPKAENVDSICIDFTNSIQKIYDDSESIQKILSEIATGKRTEKQSIQDYPSAEEYGTINIENNGGMTTMFYYEENGKYYIECPYKGIYEIENNFEDMI

bkoep Staff Lv 1

Here is the sequence logo predicted by the SAM server:

H = helix
E = sheet
C = loop (or coil)

The taller the letter at each position, the higher the probability of that specific secondary structure for that amino acid.

For example, the Isoleucines at residues 13 and 25 are highly predicted to be part of a sheet. However, the Isoleucines at residues 31 and 38 are predicted to be part of a helix!