bkoep Staff Lv 1
We're still waiting on the secondary structure predictions for this protein. Check back later for updates!
Closed since over 12 years ago
Intermediate Overall Prediction Hand-FoldingWe are giving you another currently unsolved protein as an extended chain. This round only GUI scripts are allowed and sharing has been disabled. After this puzzle expires, the puzzle will be re-posted and LUA scripts and sharing will be allowed. You'll be able to load in your solutions from this puzzle and use scripting and sharing.
No scores of this type to display!
We're still waiting on the secondary structure predictions for this protein. Check back later for updates!
SPILPKAENVDSICIDFTNSIQKIYDDSESIQKILSEIATGKRTEKQSIQDYPSAEEYGTINIENNGGMTTMFYYEENGKYYIECPYKGIYEIENNFEDMI
http://fold.it/portal/recipe/46925
Edit:
It's pretty much the same as the SAM prediction
Here is the sequence logo predicted by the SAM server:
H = helix
E = sheet
C = loop (or coil)
The taller the letter at each position, the higher the probability of that specific secondary structure for that amino acid.
For example, the Isoleucines at residues 13 and 25 are highly predicted to be part of a sheet. However, the Isoleucines at residues 31 and 38 are predicted to be part of a helix!