DUSP6 structure prediction

Started by majires

majires Lv 1

Happy Holydays. I'm master's course student in proteomics and structural biology.
I'm considering writing my courses' thesis as structure prediction of DUSP6 using foldit and precision-comparison with other similar-sequenced proteins.
As I know, crystal structure of DUSP6 isn't elucidated yet.
To get help of collective intelligence, I tried to upload the contest. But, contest can't upload 100+ Amino acids protein and I don't know exactly how contest and puzzles are work.
Therefore, could someone help me to predict that structure?

sequence of human DUSP6:
MIDTLRPVPFASEMAISKTVAWLNEQLELGNERLLLMDCRPQELYESSHIESAINVAIPG
IMLRRLQKGNLPVRALFTRGEDRDRFTRRCGTDTVVLYDESSSDWNENTGGESVLGLLLK
KLKDEGCRAFYLEGGFSKFQAEFSLHCETNLDGSCSSSSPPLPVLGLGGLRISSDSSSDI
ESDLDRDPNSATDSDGSPLSNSQPSFPVEILPFLYLGCAKDSTNLDVLEEFGIKYILNVT
PNLPNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARGKNCGVLVHCLAGISRS
VTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGLSSPCDNRVPAQ
QLYFTTPSNQNVYQVDSLQST

Domains of DUSP6 known its structure:
https://www.rcsb.org/pdb/explore/explore.do?structureId=1hzm
https://www.rcsb.org/pdb/explore/explore.do?structureId=1mkp

Skippysk8s Lv 1

Majires
Contact smortier ( nickname on foldit). She is the player contact person. Your protein is very large for those of us playing on small home machines, but some number of the large machine players might be willing to play it or perhaps she can get this posted as a contest that will run longer than a handful of days by adjusting the contest rules to allow something this large.
Best of luck. This program is based off Rosetta@home. It tends to reward helices in terms of points, but if you can get a contest up maybe you can get some ideas. We have some excellent de novo folders
Skippy

LociOiling Lv 1

The DUSP6 sequence posted is 381 residues. That's a big protein for Foldit. The recent aflatoxin puzzles were 303 residues, and about half of those were locked, preventing the backbone and sidechain from changing.

The current puzzle 1462 has 162 residues, all unlocked. That's a large protein for Foldit. Some players have computer problems with puzzles this size.

The Foldit wiki has more information about contests: http://foldit.wikia.com/wiki/Contest

Contests don't attract much attention in Foldit.

Anyone can create a contest, but contests use one of the fixed templates listed on the wiki page. These templates have not changed in several years.

[Edit: there is a variable-length design contest, updated the suggestion below.]

One possible approach is to create a contest from the "Freestyle Design: Variable Length" template. After opening the contest, adjust the number of residues, and "mutate" the residues to the desired amino acids. The updated protein can then be shared with group members.

There are some problems with the contest approach. One problem is that there is no way to "lock" the contest after the initial change, so other players could still add, delete, or mutate residues. Another problem is there's no way to share the mutated contest with all Foldit players, just members of a specific group.

A better approach would be to have part of DUSP6 presented as a "de-novo" puzzle. These puzzles have a fixed set of residues, and start as an extended chain. The Foldit science team creates the puzzles, so this is only likely to happen if DUSP6 is relevant to their research.

Bruno Kestemont Lv 1

Indeed, variable length is limited to 100 residues.
You can divide your puzzle in smaller peaces and use variable length.

or you take a bigger one (500 residues) and you (set ideal helix and) freeze the remaining part. I tried here:

http://fold.it/portal/node/2004670

It's extremely heavy to play, even with a relatively powerfull computer.