Placeholder image of a protein
Icon representing a puzzle

1061: De-novo Freestyle 49: Hand-folding Round

Closed since about 11 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Hand-Folding Hand-Folding Hand-Folding Hand-Folding Hand-Folding Hand-Folding Hand-Folding Hand-Folding Hand-Folding

Summary


Created
March 09, 2015
Expires
Max points
100
Description

In this de-novo freestyle puzzle, only GUI scripts are allowed and sharing has been disabled. After this puzzle expires, the puzzle will be reposted with LUA scripts and sharing enabled. The PSIPRED secondary structure predictions are provided on the starting model.

Top groups


  1. Avatar for Eὕρηκα! Heureka! 21. Eὕρηκα! Heureka! 1 pt. 5,705
  2. Avatar for Team Germany 22. Team Germany 1 pt. 5,497
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 4,680
  4. Avatar for It's over 9000! 24. It's over 9000! 1 pt. 3,655
  5. Avatar for SETIKAH@KOREA 25. SETIKAH@KOREA 1 pt. 3,305
  6. Avatar for BOINC@Poland 26. BOINC@Poland 1 pt. 584

  1. Avatar for PrettyPony2001 71. PrettyPony2001 Lv 1 17 pts. 8,019
  2. Avatar for Mydogisa Toelicker 72. Mydogisa Toelicker Lv 1 17 pts. 8,002
  3. Avatar for cbwest 73. cbwest Lv 1 16 pts. 8,001
  4. Avatar for ManVsYard 74. ManVsYard Lv 1 16 pts. 8,001
  5. Avatar for sheerbliss 75. sheerbliss Lv 1 15 pts. 7,998
  6. Avatar for Mr_Jolty 76. Mr_Jolty Lv 1 15 pts. 7,989
  7. Avatar for HerobrinesArmy 77. HerobrinesArmy Lv 1 14 pts. 7,973
  8. Avatar for Blipperman 78. Blipperman Lv 1 14 pts. 7,961
  9. Avatar for O Seki To 79. O Seki To Lv 1 14 pts. 7,942
  10. Avatar for arginia 80. arginia Lv 1 13 pts. 7,942

Comments


HerobrinesArmy Lv 1

It's <div style="font-size: 10px">veeifasgtwhvvdfygkanwdkrngepkynamahnpdktiategrkaldiihgfnitfkadgtftgsiqngtiegtwqadgkdrtvninftktppstsynnefiealnnaifyqgdsnvlllapegkktyiqfahnkqd</div> in case anyone wants to run their own secondary structure predictions.