Placeholder image of a protein
Icon representing a puzzle

1110: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
July 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Russian team 11. Russian team 4 pts. 8,670
  2. Avatar for Deleted group 12. Deleted group pts. 8,628
  3. Avatar for xkcd 13. xkcd 2 pts. 8,623
  4. Avatar for Natural Abilities 14. Natural Abilities 1 pt. 8,502
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,478
  6. Avatar for Minions of TWIS 16. Minions of TWIS 1 pt. 8,435
  7. Avatar for It's over 9000! 17. It's over 9000! 1 pt. 8,398
  8. Avatar for freefolder 18. freefolder 1 pt. 8,397
  9. Avatar for Dnice.dk 19. Dnice.dk 1 pt. 8,367
  10. Avatar for CureCoin 20. CureCoin 1 pt. 8,014

  1. Avatar for HJCW 161. HJCW Lv 1 1 pt. 8,316
  2. Avatar for yiminjune 162. yiminjune Lv 1 1 pt. 8,311
  3. Avatar for lacie 163. lacie Lv 1 1 pt. 8,301
  4. Avatar for mirjamvandelft 164. mirjamvandelft Lv 1 1 pt. 8,271
  5. Avatar for AryehK 165. AryehK Lv 1 1 pt. 8,266
  6. Avatar for SpikRMX 166. SpikRMX Lv 1 1 pt. 8,218
  7. Avatar for Rapture1997 167. Rapture1997 Lv 1 1 pt. 8,204
  8. Avatar for Andi1960 168. Andi1960 Lv 1 1 pt. 8,190
  9. Avatar for WBarme1234 169. WBarme1234 Lv 1 1 pt. 8,177
  10. Avatar for Jajaboman 170. Jajaboman Lv 1 1 pt. 8,164

Comments