Placeholder image of a protein
Icon representing a puzzle

1110: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
July 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for DSN @ Home 21. DSN @ Home 1 pt. 7,006

  1. Avatar for crpainter 91. crpainter Lv 1 13 pts. 8,606
  2. Avatar for proteansoup 92. proteansoup Lv 1 12 pts. 8,590
  3. Avatar for SouperGenious 93. SouperGenious Lv 1 12 pts. 8,588
  4. Avatar for dettingen 94. dettingen Lv 1 12 pts. 8,579
  5. Avatar for SKSbell 95. SKSbell Lv 1 11 pts. 8,570
  6. Avatar for Jim Fraser 96. Jim Fraser Lv 1 11 pts. 8,561
  7. Avatar for Superphosphate 97. Superphosphate Lv 1 11 pts. 8,559
  8. Avatar for armaholik 98. armaholik Lv 1 11 pts. 8,557
  9. Avatar for fishercat 99. fishercat Lv 1 10 pts. 8,551
  10. Avatar for ManVsYard 100. ManVsYard Lv 1 10 pts. 8,546

Comments