Placeholder image of a protein
Icon representing a puzzle

1110: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for DSN @ Home 21. DSN @ Home 1 pt. 7,006
  1. Avatar for Merf 141. Merf Lv 1 3 pts. 8,424
  2. Avatar for jebbiek 142. jebbiek Lv 1 3 pts. 8,411
  3. Avatar for BCAA 143. BCAA Lv 1 3 pts. 8,398
  4. Avatar for leehaggis 144. leehaggis Lv 1 2 pts. 8,397
  5. Avatar for Altercomp 145. Altercomp Lv 1 2 pts. 8,397
  6. Avatar for meatexplosion 146. meatexplosion Lv 1 2 pts. 8,392
  7. Avatar for hapalops 147. hapalops Lv 1 2 pts. 8,385
  8. Avatar for TomTaylor 148. TomTaylor Lv 1 2 pts. 8,376
  9. Avatar for Plumby 149. Plumby Lv 1 2 pts. 8,367
  10. Avatar for pumtex 150. pumtex Lv 1 2 pts. 8,367

Comments