Placeholder image of a protein
Icon representing a puzzle

1110: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for DSN @ Home 21. DSN @ Home 1 pt. 7,006
  1. Avatar for toni1223 151. toni1223 Lv 1 2 pts. 8,360
  2. Avatar for bwkittitas 152. bwkittitas Lv 1 2 pts. 8,360
  3. Avatar for jermainiac 153. jermainiac Lv 1 2 pts. 8,351
  4. Avatar for taminnugget 154. taminnugget Lv 1 2 pts. 8,344
  5. Avatar for wosser1 155. wosser1 Lv 1 2 pts. 8,344
  6. Avatar for brgreening 156. brgreening Lv 1 2 pts. 8,343
  7. Avatar for pandabearsecond 157. pandabearsecond Lv 1 2 pts. 8,338
  8. Avatar for Soggy Doglog 158. Soggy Doglog Lv 1 2 pts. 8,333
  9. Avatar for tela 159. tela Lv 1 2 pts. 8,330
  10. Avatar for DScott 160. DScott Lv 1 1 pt. 8,330

Comments