Placeholder image of a protein
Icon representing a puzzle

1110: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for DSN @ Home 21. DSN @ Home 1 pt. 7,006
  1. Avatar for lange 171. lange Lv 1 1 pt. 8,163
  2. Avatar for inkycatz 172. inkycatz Lv 1 1 pt. 8,142
  3. Avatar for Arne Heessels 173. Arne Heessels Lv 1 1 pt. 8,141
  4. Avatar for rezaefar 174. rezaefar Lv 1 1 pt. 8,115
  5. Avatar for jdmclure 175. jdmclure Lv 1 1 pt. 8,112
  6. Avatar for bmoore31 176. bmoore31 Lv 1 1 pt. 8,108
  7. Avatar for FishKAA 177. FishKAA Lv 1 1 pt. 8,091
  8. Avatar for Close At Hand 178. Close At Hand Lv 1 1 pt. 8,084
  9. Avatar for kuuichi09 179. kuuichi09 Lv 1 1 pt. 8,065
  10. Avatar for Idiotboy 180. Idiotboy Lv 1 1 pt. 8,061

Comments