Placeholder image of a protein
Icon representing a puzzle

1110: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for DSN @ Home 21. DSN @ Home 1 pt. 7,006
  1. Avatar for ladydragon6 181. ladydragon6 Lv 1 1 pt. 8,056
  2. Avatar for cor2020 182. cor2020 Lv 1 1 pt. 8,055
  3. Avatar for Ashrai 183. Ashrai Lv 1 1 pt. 8,047
  4. Avatar for GenVeers 184. GenVeers Lv 1 1 pt. 8,039
  5. Avatar for wilding2004 185. wilding2004 Lv 1 1 pt. 8,014
  6. Avatar for 01010011111 186. 01010011111 Lv 1 1 pt. 8,012
  7. Avatar for NotJim99 187. NotJim99 Lv 1 1 pt. 8,005
  8. Avatar for Mike Cassidy 188. Mike Cassidy Lv 1 1 pt. 7,993
  9. Avatar for v4mp1r3 189. v4mp1r3 Lv 1 1 pt. 7,989
  10. Avatar for Skymeat 190. Skymeat Lv 1 1 pt. 7,965

Comments