Placeholder image of a protein
Icon representing a puzzle

1110: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for DSN @ Home 21. DSN @ Home 1 pt. 7,006
  1. Avatar for momadoc 191. momadoc Lv 1 1 pt. 7,960
  2. Avatar for student01 192. student01 Lv 1 1 pt. 7,943
  3. Avatar for AruBunny 193. AruBunny Lv 1 1 pt. 7,940
  4. Avatar for nikanick11 194. nikanick11 Lv 1 1 pt. 7,934
  5. Avatar for Tonet 195. Tonet Lv 1 1 pt. 7,926
  6. Avatar for nemo7731 196. nemo7731 Lv 1 1 pt. 7,917
  7. Avatar for emdee314 197. emdee314 Lv 1 1 pt. 7,898
  8. Avatar for lucachersoni 198. lucachersoni Lv 1 1 pt. 7,872
  9. Avatar for DLXX 199. DLXX Lv 1 1 pt. 7,856
  10. Avatar for MonkeyGod 200. MonkeyGod Lv 1 1 pt. 7,853

Comments