Placeholder image of a protein
Icon representing a puzzle

1110: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for DSN @ Home 21. DSN @ Home 1 pt. 7,006
  1. Avatar for marillia360 221. marillia360 Lv 1 1 pt. 7,709
  2. Avatar for General Custard 222. General Custard Lv 1 1 pt. 7,708
  3. Avatar for JohnArkas 223. JohnArkas Lv 1 1 pt. 7,681
  4. Avatar for romanus 224. romanus Lv 1 1 pt. 7,679
  5. Avatar for Vampyricon 225. Vampyricon Lv 1 1 pt. 7,654
  6. Avatar for Echo.ControverC 226. Echo.ControverC Lv 1 1 pt. 7,651
  7. Avatar for dpan 227. dpan Lv 1 1 pt. 7,648
  8. Avatar for Ellis Shih 228. Ellis Shih Lv 1 1 pt. 7,648
  9. Avatar for joublot76 229. joublot76 Lv 1 1 pt. 7,624
  10. Avatar for boondog 230. boondog Lv 1 1 pt. 7,624

Comments