Placeholder image of a protein
Icon representing a puzzle

1110: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for DSN @ Home 21. DSN @ Home 1 pt. 7,006
  1. Avatar for SuperSquirrel51 241. SuperSquirrel51 Lv 1 1 pt. 7,310
  2. Avatar for Spaceship732 242. Spaceship732 Lv 1 1 pt. 7,295
  3. Avatar for michael0095 243. michael0095 Lv 1 1 pt. 7,287
  4. Avatar for chomihyun 244. chomihyun Lv 1 1 pt. 7,263
  5. Avatar for agnairt 245. agnairt Lv 1 1 pt. 7,261
  6. Avatar for broday 246. broday Lv 1 1 pt. 7,253
  7. Avatar for eromana 247. eromana Lv 1 1 pt. 7,248
  8. Avatar for guineapig 248. guineapig Lv 1 1 pt. 7,237
  9. Avatar for Deleted player 249. Deleted player pts. 7,212
  10. Avatar for Ameobaman 250. Ameobaman Lv 1 1 pt. 7,159

Comments