Placeholder image of a protein
Icon representing a puzzle

1110: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for DSN @ Home 21. DSN @ Home 1 pt. 7,006
  1. Avatar for aspadistra 251. aspadistra Lv 1 1 pt. 7,006
  2. Avatar for Xiomerra 252. Xiomerra Lv 1 1 pt. 6,818
  3. Avatar for Notlawgnut 253. Notlawgnut Lv 1 1 pt. 6,132
  4. Avatar for phi16 254. phi16 Lv 1 1 pt. 3,772
  5. Avatar for glaciall 255. glaciall Lv 1 1 pt. 3,772
  6. Avatar for mapoling 256. mapoling Lv 1 1 pt. 3,772
  7. Avatar for Martyy 257. Martyy Lv 1 1 pt. 3,772
  8. Avatar for aminaman 258. aminaman Lv 1 1 pt. 3,772
  9. Avatar for packer 259. packer Lv 1 1 pt. 3,772
  10. Avatar for Deleted player 260. Deleted player pts. 3,772

Comments