Placeholder image of a protein
Icon representing a puzzle

1110: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since almost 11 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for DSN @ Home 21. DSN @ Home 1 pt. 7,006

  1. Avatar for O Seki To 31. O Seki To Lv 1 55 pts. 8,863
  2. Avatar for cbwest 32. cbwest Lv 1 54 pts. 8,861
  3. Avatar for silverberg 33. silverberg Lv 1 53 pts. 8,859
  4. Avatar for steveB 34. steveB Lv 1 52 pts. 8,858
  5. Avatar for Paulo Roque 35. Paulo Roque Lv 1 51 pts. 8,851
  6. Avatar for pmdpmd 36. pmdpmd Lv 1 49 pts. 8,840
  7. Avatar for Giant Berk 37. Giant Berk Lv 1 48 pts. 8,839
  8. Avatar for nicobul 38. nicobul Lv 1 47 pts. 8,838
  9. Avatar for Vredeman 39. Vredeman Lv 1 46 pts. 8,836
  10. Avatar for johngran 40. johngran Lv 1 45 pts. 8,834

Comments