Placeholder image of a protein
Icon representing a puzzle

1110: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for DSN @ Home 21. DSN @ Home 1 pt. 7,006
  1. Avatar for JUMELLE54 81. JUMELLE54 Lv 1 17 pts. 8,640
  2. Avatar for zoriuq 82. zoriuq Lv 1 16 pts. 8,638
  3. Avatar for Punktchen 83. Punktchen Lv 1 16 pts. 8,633
  4. Avatar for ecali 84. ecali Lv 1 16 pts. 8,630
  5. Avatar for Amphimixus 85. Amphimixus Lv 1 15 pts. 8,628
  6. Avatar for Glen B 86. Glen B Lv 1 15 pts. 8,624
  7. Avatar for fryguy 87. fryguy Lv 1 14 pts. 8,623
  8. Avatar for greepski 88. greepski Lv 1 14 pts. 8,620
  9. Avatar for dahast.de 89. dahast.de Lv 1 14 pts. 8,619
  10. Avatar for Iron pet 90. Iron pet Lv 1 13 pts. 8,608

Comments