Placeholder image of a protein
Icon representing a puzzle

1111: Unsolved De-novo Freestyle 53

Closed since almost 11 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 07, 2015
Expires
Max points
100
Description

This protein is known to activate cysteine desulferase, an enzyme that converts cysteine to alanine by transferring a sulfur atom. The structure of this protein is still unsolved. The PSIPRED secondary structure predictions are provided on the starting model.



Sequence:

MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH

Top groups


  1. Avatar for Androids 21. Androids 1 pt. 7,234
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 5,220
  3. Avatar for It's over 9000! 23. It's over 9000! 1 pt. 0

  1. Avatar for Superphosphate 101. Superphosphate Lv 1 11 pts. 8,383
  2. Avatar for guineapig 102. guineapig Lv 1 11 pts. 8,381
  3. Avatar for Mydogisa Toelicker 103. Mydogisa Toelicker Lv 1 11 pts. 8,373
  4. Avatar for Pro Lapser 104. Pro Lapser Lv 1 10 pts. 8,367
  5. Avatar for Grom 105. Grom Lv 1 10 pts. 8,364
  6. Avatar for pizpot 106. pizpot Lv 1 10 pts. 8,358
  7. Avatar for inkycatz 107. inkycatz Lv 1 9 pts. 8,352
  8. Avatar for harvardman 108. harvardman Lv 1 9 pts. 8,351
  9. Avatar for smilingone 109. smilingone Lv 1 9 pts. 8,349
  10. Avatar for Festering Wounds 110. Festering Wounds Lv 1 9 pts. 8,344

Comments