1111: Unsolved De-novo Freestyle 53
Closed since over 10 years ago
Intermediate Overall PredictionSummary
- Created
- July 07, 2015
- Expires
- Max points
- 100
This protein is known to activate cysteine desulferase, an enzyme that converts cysteine to alanine by transferring a sulfur atom. The structure of this protein is still unsolved. The PSIPRED secondary structure predictions are provided on the starting model.
Sequence:
MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH
Top groups
-
100 pts. 9,155
-
-
-
-
-
-
-
-
-