Placeholder image of a protein
Icon representing a puzzle

1111: Unsolved De-novo Freestyle 53

Closed since almost 11 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 07, 2015
Expires
Max points
100
Description

This protein is known to activate cysteine desulferase, an enzyme that converts cysteine to alanine by transferring a sulfur atom. The structure of this protein is still unsolved. The PSIPRED secondary structure predictions are provided on the starting model.



Sequence:

MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,155
  2. Avatar for Beta Folders 2. Beta Folders 80 pts. 9,140
  3. Avatar for Contenders 3. Contenders 63 pts. 9,133
  4. Avatar for Void Crushers 4. Void Crushers 49 pts. 9,112
  5. Avatar for Go Science 5. Go Science 37 pts. 9,075
  6. Avatar for Gargleblasters 6. Gargleblasters 28 pts. 9,032
  7. Avatar for Deleted group 7. Deleted group pts. 8,943
  8. Avatar for HMT heritage 8. HMT heritage 15 pts. 8,930
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 11 pts. 8,853
  10. Avatar for Deleted group 10. Deleted group pts. 8,709

  1. Avatar for Bautho 71. Bautho Lv 1 24 pts. 8,590
  2. Avatar for caglar 72. caglar Lv 1 23 pts. 8,589
  3. Avatar for phi16 73. phi16 Lv 1 23 pts. 8,580
  4. Avatar for Sadler 74. Sadler Lv 1 22 pts. 8,568
  5. Avatar for Mike Cassidy 75. Mike Cassidy Lv 1 22 pts. 8,539
  6. Avatar for jobo0502 76. jobo0502 Lv 1 21 pts. 8,537
  7. Avatar for tallguy-13088 77. tallguy-13088 Lv 1 21 pts. 8,522
  8. Avatar for isaksson 78. isaksson Lv 1 20 pts. 8,519
  9. Avatar for stomjoh 79. stomjoh Lv 1 20 pts. 8,519
  10. Avatar for jermainiac 80. jermainiac Lv 1 19 pts. 8,517

Comments