Placeholder image of a protein
Icon representing a puzzle

1113: Revisiting Puzzle 82: Cytotoxin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 4 pts. 8,607
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 8,454
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 8,425
  4. Avatar for It's over 9000! 14. It's over 9000! 1 pt. 8,272
  5. Avatar for xkcd 15. xkcd 1 pt. 8,246
  6. Avatar for Deleted group 16. Deleted group pts. 8,122
  7. Avatar for Russian team 17. Russian team 1 pt. 7,944
  8. Avatar for freefolder 18. freefolder 1 pt. 7,616
  9. Avatar for Androids 19. Androids 1 pt. 7,265
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 6,698
  1. Avatar for rinze 131. rinze Lv 1 3 pts. 7,928
  2. Avatar for hada 132. hada Lv 1 3 pts. 7,903
  3. Avatar for xxxNaGiBaToR-228xxx 133. xxxNaGiBaToR-228xxx Lv 1 3 pts. 7,870
  4. Avatar for ViJay7019 134. ViJay7019 Lv 1 3 pts. 7,863
  5. Avatar for sagan de castro 135. sagan de castro Lv 1 3 pts. 7,832
  6. Avatar for leader425 136. leader425 Lv 1 3 pts. 7,827
  7. Avatar for pfeiffelfloyd 137. pfeiffelfloyd Lv 1 3 pts. 7,803
  8. Avatar for dahast.de 138. dahast.de Lv 1 2 pts. 7,781
  9. Avatar for NotJim99 139. NotJim99 Lv 1 2 pts. 7,759
  10. Avatar for lamoille 140. lamoille Lv 1 2 pts. 7,757

Comments