Placeholder image of a protein
Icon representing a puzzle

1113: Revisiting Puzzle 82: Cytotoxin

Closed since almost 11 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups


  1. Avatar for L'Alliance Francophone 100 pts. 9,204
  2. Avatar for Beta Folders 2. Beta Folders 78 pts. 9,153
  3. Avatar for Gargleblasters 3. Gargleblasters 60 pts. 9,138
  4. Avatar for Contenders 4. Contenders 45 pts. 9,078
  5. Avatar for Go Science 5. Go Science 33 pts. 9,052
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 24 pts. 8,988
  7. Avatar for Deleted group 7. Deleted group pts. 8,911
  8. Avatar for Deleted group 8. Deleted group pts. 8,901
  9. Avatar for Void Crushers 9. Void Crushers 8 pts. 8,886
  10. Avatar for HMT heritage 10. HMT heritage 6 pts. 8,685

  1. Avatar for rinze 131. rinze Lv 1 3 pts. 7,928
  2. Avatar for hada 132. hada Lv 1 3 pts. 7,903
  3. Avatar for xxxNaGiBaToR-228xxx 133. xxxNaGiBaToR-228xxx Lv 1 3 pts. 7,870
  4. Avatar for ViJay7019 134. ViJay7019 Lv 1 3 pts. 7,863
  5. Avatar for sagan de castro 135. sagan de castro Lv 1 3 pts. 7,832
  6. Avatar for leader425 136. leader425 Lv 1 3 pts. 7,827
  7. Avatar for pfeiffelfloyd 137. pfeiffelfloyd Lv 1 3 pts. 7,803
  8. Avatar for dahast.de 138. dahast.de Lv 1 2 pts. 7,781
  9. Avatar for NotJim99 139. NotJim99 Lv 1 2 pts. 7,759
  10. Avatar for lamoille 140. lamoille Lv 1 2 pts. 7,757

Comments