Placeholder image of a protein
Icon representing a puzzle

1113: Revisiting Puzzle 82: Cytotoxin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
July 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 4 pts. 8,607
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 8,454
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 8,425
  4. Avatar for It's over 9000! 14. It's over 9000! 1 pt. 8,272
  5. Avatar for xkcd 15. xkcd 1 pt. 8,246
  6. Avatar for Deleted group 16. Deleted group pts. 8,122
  7. Avatar for Russian team 17. Russian team 1 pt. 7,944
  8. Avatar for freefolder 18. freefolder 1 pt. 7,616
  9. Avatar for Androids 19. Androids 1 pt. 7,265
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 6,698

  1. Avatar for harvardman 181. harvardman Lv 1 1 pt. 7,292
  2. Avatar for phi16 182. phi16 Lv 1 1 pt. 7,289
  3. Avatar for Helmke 183. Helmke Lv 1 1 pt. 7,265
  4. Avatar for taminnugget 184. taminnugget Lv 1 1 pt. 7,257
  5. Avatar for Simek 185. Simek Lv 1 1 pt. 7,257
  6. Avatar for birkett83 186. birkett83 Lv 1 1 pt. 7,254
  7. Avatar for geoff.watson 187. geoff.watson Lv 1 1 pt. 7,241
  8. Avatar for abnormallynormal 188. abnormallynormal Lv 1 1 pt. 7,238
  9. Avatar for jencimons 189. jencimons Lv 1 1 pt. 7,215
  10. Avatar for Inkedhands 190. Inkedhands Lv 1 1 pt. 7,213

Comments