Placeholder image of a protein
Icon representing a puzzle

1113: Revisiting Puzzle 82: Cytotoxin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for L'Alliance Francophone
    1. L'Alliance Francophone
    100 pts. 9,204
  2. Avatar for Beta Folders 2. Beta Folders 78 pts. 9,153
  3. Avatar for Gargleblasters 3. Gargleblasters 60 pts. 9,138
  4. Avatar for Contenders 4. Contenders 45 pts. 9,078
  5. Avatar for Go Science 5. Go Science 33 pts. 9,052
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 24 pts. 8,988
  7. Avatar for Deleted group 7. Deleted group pts. 8,911
  8. Avatar for Deleted group 8. Deleted group pts. 8,901
  9. Avatar for Void Crushers 9. Void Crushers 8 pts. 8,886
  10. Avatar for HMT heritage 10. HMT heritage 6 pts. 8,685
  1. Avatar for harvardman 181. harvardman Lv 1 1 pt. 7,292
  2. Avatar for phi16 182. phi16 Lv 1 1 pt. 7,289
  3. Avatar for Helmke 183. Helmke Lv 1 1 pt. 7,265
  4. Avatar for taminnugget 184. taminnugget Lv 1 1 pt. 7,257
  5. Avatar for Simek 185. Simek Lv 1 1 pt. 7,257
  6. Avatar for birkett83 186. birkett83 Lv 1 1 pt. 7,254
  7. Avatar for geoff.watson 187. geoff.watson Lv 1 1 pt. 7,241
  8. Avatar for abnormallynormal 188. abnormallynormal Lv 1 1 pt. 7,238
  9. Avatar for jencimons 189. jencimons Lv 1 1 pt. 7,215
  10. Avatar for Inkedhands 190. Inkedhands Lv 1 1 pt. 7,213

Comments