Placeholder image of a protein
Icon representing a puzzle

1113: Revisiting Puzzle 82: Cytotoxin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 4 pts. 8,607
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 8,454
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 8,425
  4. Avatar for It's over 9000! 14. It's over 9000! 1 pt. 8,272
  5. Avatar for xkcd 15. xkcd 1 pt. 8,246
  6. Avatar for Deleted group 16. Deleted group pts. 8,122
  7. Avatar for Russian team 17. Russian team 1 pt. 7,944
  8. Avatar for freefolder 18. freefolder 1 pt. 7,616
  9. Avatar for Androids 19. Androids 1 pt. 7,265
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 6,698
  1. Avatar for cnhrcolemam 191. cnhrcolemam Lv 1 1 pt. 7,189
  2. Avatar for dbot67 192. dbot67 Lv 1 1 pt. 7,169
  3. Avatar for Arne Heessels 193. Arne Heessels Lv 1 1 pt. 7,161
  4. Avatar for Bierworst 194. Bierworst Lv 1 1 pt. 7,158
  5. Avatar for parsnip 195. parsnip Lv 1 1 pt. 7,155
  6. Avatar for cor2020 196. cor2020 Lv 1 1 pt. 7,147
  7. Avatar for Stevieboy 197. Stevieboy Lv 1 1 pt. 7,132
  8. Avatar for agnairt 198. agnairt Lv 1 1 pt. 7,124
  9. Avatar for MonkeyGod 199. MonkeyGod Lv 1 1 pt. 7,109
  10. Avatar for landfrda 200. landfrda Lv 1 1 pt. 7,076

Comments