Placeholder image of a protein
Icon representing a puzzle

1113: Revisiting Puzzle 82: Cytotoxin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for L'Alliance Francophone
    1. L'Alliance Francophone
    100 pts. 9,204
  2. Avatar for Beta Folders 2. Beta Folders 78 pts. 9,153
  3. Avatar for Gargleblasters 3. Gargleblasters 60 pts. 9,138
  4. Avatar for Contenders 4. Contenders 45 pts. 9,078
  5. Avatar for Go Science 5. Go Science 33 pts. 9,052
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 24 pts. 8,988
  7. Avatar for Deleted group 7. Deleted group pts. 8,911
  8. Avatar for Deleted group 8. Deleted group pts. 8,901
  9. Avatar for Void Crushers 9. Void Crushers 8 pts. 8,886
  10. Avatar for HMT heritage 10. HMT heritage 6 pts. 8,685
  1. Avatar for cnhrcolemam 191. cnhrcolemam Lv 1 1 pt. 7,189
  2. Avatar for dbot67 192. dbot67 Lv 1 1 pt. 7,169
  3. Avatar for Arne Heessels 193. Arne Heessels Lv 1 1 pt. 7,161
  4. Avatar for Bierworst 194. Bierworst Lv 1 1 pt. 7,158
  5. Avatar for parsnip 195. parsnip Lv 1 1 pt. 7,155
  6. Avatar for cor2020 196. cor2020 Lv 1 1 pt. 7,147
  7. Avatar for Stevieboy 197. Stevieboy Lv 1 1 pt. 7,132
  8. Avatar for agnairt 198. agnairt Lv 1 1 pt. 7,124
  9. Avatar for MonkeyGod 199. MonkeyGod Lv 1 1 pt. 7,109
  10. Avatar for landfrda 200. landfrda Lv 1 1 pt. 7,076

Comments