Placeholder image of a protein
Icon representing a puzzle

1113: Revisiting Puzzle 82: Cytotoxin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 4 pts. 8,607
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 8,454
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 8,425
  4. Avatar for It's over 9000! 14. It's over 9000! 1 pt. 8,272
  5. Avatar for xkcd 15. xkcd 1 pt. 8,246
  6. Avatar for Deleted group 16. Deleted group pts. 8,122
  7. Avatar for Russian team 17. Russian team 1 pt. 7,944
  8. Avatar for freefolder 18. freefolder 1 pt. 7,616
  9. Avatar for Androids 19. Androids 1 pt. 7,265
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 6,698
  1. Avatar for JohnTJC 231. JohnTJC Lv 1 1 pt. 6,741
  2. Avatar for aspadistra 232. aspadistra Lv 1 1 pt. 6,698
  3. Avatar for smarthuman 233. smarthuman Lv 1 1 pt. 6,696
  4. Avatar for ivalnic 234. ivalnic Lv 1 1 pt. 6,675
  5. Avatar for milunka 235. milunka Lv 1 1 pt. 6,674
  6. Avatar for Froobyflake 236. Froobyflake Lv 1 1 pt. 6,645
  7. Avatar for AruBunny 237. AruBunny Lv 1 1 pt. 6,621
  8. Avatar for laczek 238. laczek Lv 1 1 pt. 6,614
  9. Avatar for Protocell 239. Protocell Lv 1 1 pt. 6,599
  10. Avatar for MadCat08 240. MadCat08 Lv 1 1 pt. 6,575

Comments