Placeholder image of a protein
Icon representing a puzzle

1113: Revisiting Puzzle 82: Cytotoxin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for L'Alliance Francophone
    1. L'Alliance Francophone
    100 pts. 9,204
  2. Avatar for Beta Folders 2. Beta Folders 78 pts. 9,153
  3. Avatar for Gargleblasters 3. Gargleblasters 60 pts. 9,138
  4. Avatar for Contenders 4. Contenders 45 pts. 9,078
  5. Avatar for Go Science 5. Go Science 33 pts. 9,052
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 24 pts. 8,988
  7. Avatar for Deleted group 7. Deleted group pts. 8,911
  8. Avatar for Deleted group 8. Deleted group pts. 8,901
  9. Avatar for Void Crushers 9. Void Crushers 8 pts. 8,886
  10. Avatar for HMT heritage 10. HMT heritage 6 pts. 8,685
  1. Avatar for JohnTJC 231. JohnTJC Lv 1 1 pt. 6,741
  2. Avatar for aspadistra 232. aspadistra Lv 1 1 pt. 6,698
  3. Avatar for smarthuman 233. smarthuman Lv 1 1 pt. 6,696
  4. Avatar for ivalnic 234. ivalnic Lv 1 1 pt. 6,675
  5. Avatar for milunka 235. milunka Lv 1 1 pt. 6,674
  6. Avatar for Froobyflake 236. Froobyflake Lv 1 1 pt. 6,645
  7. Avatar for AruBunny 237. AruBunny Lv 1 1 pt. 6,621
  8. Avatar for laczek 238. laczek Lv 1 1 pt. 6,614
  9. Avatar for Protocell 239. Protocell Lv 1 1 pt. 6,599
  10. Avatar for MadCat08 240. MadCat08 Lv 1 1 pt. 6,575

Comments