Placeholder image of a protein
Icon representing a puzzle

1113: Revisiting Puzzle 82: Cytotoxin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
July 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups


  1. Avatar for CureCoin 21. CureCoin 1 pt. 6,696

  1. Avatar for dbuske 111. dbuske Lv 1 6 pts. 8,212
  2. Avatar for georg137 112. georg137 Lv 1 6 pts. 8,212
  3. Avatar for joaniegirl 113. joaniegirl Lv 1 6 pts. 8,203
  4. Avatar for packer 114. packer Lv 1 6 pts. 8,178
  5. Avatar for TomTaylor 115. TomTaylor Lv 1 5 pts. 8,165
  6. Avatar for Mike Cassidy 116. Mike Cassidy Lv 1 5 pts. 8,163
  7. Avatar for Iron pet 117. Iron pet Lv 1 5 pts. 8,140
  8. Avatar for alwen 118. alwen Lv 1 5 pts. 8,134
  9. Avatar for Deleted player 119. Deleted player pts. 8,122
  10. Avatar for abiogenesis 120. abiogenesis Lv 1 5 pts. 8,104

Comments