Placeholder image of a protein
Icon representing a puzzle

1113: Revisiting Puzzle 82: Cytotoxin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for L'Alliance Francophone
    1. L'Alliance Francophone
    100 pts. 9,204
  2. Avatar for Beta Folders 2. Beta Folders 78 pts. 9,153
  3. Avatar for Gargleblasters 3. Gargleblasters 60 pts. 9,138
  4. Avatar for Contenders 4. Contenders 45 pts. 9,078
  5. Avatar for Go Science 5. Go Science 33 pts. 9,052
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 24 pts. 8,988
  7. Avatar for Deleted group 7. Deleted group pts. 8,911
  8. Avatar for Deleted group 8. Deleted group pts. 8,901
  9. Avatar for Void Crushers 9. Void Crushers 8 pts. 8,886
  10. Avatar for HMT heritage 10. HMT heritage 6 pts. 8,685
  1. Avatar for dbuske 111. dbuske Lv 1 6 pts. 8,212
  2. Avatar for georg137 112. georg137 Lv 1 6 pts. 8,212
  3. Avatar for joaniegirl 113. joaniegirl Lv 1 6 pts. 8,203
  4. Avatar for packer 114. packer Lv 1 6 pts. 8,178
  5. Avatar for TomTaylor 115. TomTaylor Lv 1 5 pts. 8,165
  6. Avatar for Mike Cassidy 116. Mike Cassidy Lv 1 5 pts. 8,163
  7. Avatar for Iron pet 117. Iron pet Lv 1 5 pts. 8,140
  8. Avatar for alwen 118. alwen Lv 1 5 pts. 8,134
  9. Avatar for Deleted player 119. Deleted player pts. 8,122
  10. Avatar for abiogenesis 120. abiogenesis Lv 1 5 pts. 8,104

Comments