Placeholder image of a protein
Icon representing a puzzle

1113: Revisiting Puzzle 82: Cytotoxin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
July 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups


  1. Avatar for CureCoin 21. CureCoin 1 pt. 6,696

  1. Avatar for LociOiling 11. LociOiling Lv 1 82 pts. 9,035
  2. Avatar for johnmitch 12. johnmitch Lv 1 80 pts. 9,026
  3. Avatar for zeroblue 13. zeroblue Lv 1 79 pts. 9,021
  4. Avatar for viosca 14. viosca Lv 1 77 pts. 8,988
  5. Avatar for gitwut 15. gitwut Lv 1 76 pts. 8,983
  6. Avatar for bertro 16. bertro Lv 1 74 pts. 8,980
  7. Avatar for Deleted player 17. Deleted player pts. 8,970
  8. Avatar for Galaxie 18. Galaxie Lv 1 71 pts. 8,970
  9. Avatar for aznarog 19. aznarog Lv 1 70 pts. 8,960
  10. Avatar for gloverd 20. gloverd Lv 1 68 pts. 8,959

Comments