1113: Revisiting Puzzle 82: Cytotoxin
Closed since over 10 years ago
Intermediate Overall PredictionSummary
- Created
- July 13, 2015
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN
Top groups
-
100 pts. 9,204
-
-
-
-
-
-
-
-
-