1113: Revisiting Puzzle 82: Cytotoxin

Closed since over 10 years ago

Summary

• Created: July 13, 2015
• Expires: July 21, 2015 at 11:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

• 1. L'Alliance Francophone 100 pts. 9,204
• 2. Beta Folders 78 pts. 9,153
• 3. Gargleblasters 60 pts. 9,138
• 4. Contenders 45 pts. 9,078
• 5. Go Science 33 pts. 9,052
• 6. Anthropic Dreams 24 pts. 8,988
• 7. Deleted group pts. 8,911
• 8. Deleted group pts. 8,901
• 9. Void Crushers 8 pts. 8,886
• 10. HMT heritage 6 pts. 8,685

Top soloists

• 41. goastano 43 pts. 8,801
• 42. hpaege 42 pts. 8,801
• 43. Jim Fraser 41 pts. 8,787
• 44. Anfinsen_slept_here 40 pts. 8,782
• 45. martin.szew 39 pts. 8,774
• 46. pvc78 38 pts. 8,758
• 47. cbwest 37 pts. 8,744
• 48. Museka 36 pts. 8,741
• 49. joremen 35 pts. 8,731
• 50. proteansoup 34 pts. 8,728