Placeholder image of a protein
Icon representing a puzzle

1114: Unsolved De-novo Freestyle 53: Predicted Contacts

Closed since almost 11 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Predicted Contacts Predicted Contacts Predicted Contacts Predicted Contacts Predicted Contacts Predicted Contacts Predicted Contacts Predicted Contacts Predicted Contacts Predicted Contacts

Summary


Created
July 15, 2015
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1111, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1111 and use them as a starting point here.



Sequence:

MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 4 pts. 9,966
  2. Avatar for Deleted group 12. Deleted group pts. 9,952
  3. Avatar for Natural Abilities 13. Natural Abilities 2 pts. 9,757
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 9,683
  5. Avatar for freefolder 15. freefolder 1 pt. 9,522
  6. Avatar for Deleted group 17. Deleted group pts. 9,490
  7. Avatar for CureCoin 18. CureCoin 1 pt. 6,973
  8. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 5,895
  9. Avatar for IDCYNHTI2015 20. IDCYNHTI2015 1 pt. 5,340

  1. Avatar for Timo van der Laan 21. Timo van der Laan Lv 1 66 pts. 10,684
  2. Avatar for g_b 22. g_b Lv 1 65 pts. 10,656
  3. Avatar for frood66 23. frood66 Lv 1 64 pts. 10,649
  4. Avatar for Bruno Kestemont 24. Bruno Kestemont Lv 1 62 pts. 10,614
  5. Avatar for mirp 25. mirp Lv 1 61 pts. 10,612
  6. Avatar for goastano 26. goastano Lv 1 60 pts. 10,608
  7. Avatar for viosca 27. viosca Lv 1 58 pts. 10,604
  8. Avatar for spvincent 28. spvincent Lv 1 57 pts. 10,598
  9. Avatar for egran48 29. egran48 Lv 1 56 pts. 10,578
  10. Avatar for Blipperman 30. Blipperman Lv 1 54 pts. 10,566

Comments