1114: Unsolved De-novo Freestyle 53: Predicted Contacts

Closed since over 10 years ago

Summary

• Created: July 15, 2015
• Expires: July 22, 2015 at 23:00 UTC
• Max points: 100

Description

This is a follow-up puzzle for Puzzle 1111, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1111 and use them as a starting point here.



Sequence:

MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH

Top groups

• 1. Anthropic Dreams 100 pts. 11,503
• 2. Beta Folders 79 pts. 11,010
• 3. Go Science 61 pts. 10,954
• 4. Void Crushers 47 pts. 10,943
• 5. Contenders 35 pts. 10,882
• 6. L'Alliance Francophone 26 pts. 10,794
• 7. Gargleblasters 19 pts. 10,675
• 8. Deleted group pts. 10,559
• 9. HMT heritage 10 pts. 10,387
• 10. xkcd 7 pts. 10,064

Top soloists

• 1. Susume 100 pts. 11,380
• 2. MurloW 99 pts. 11,127
• 3. hpaege 97 pts. 11,034
• 4. retiredmichael 95 pts. 10,991
• 5. pauldunn 93 pts. 10,947
• 6. Madde 91 pts. 10,936
• 7. Galaxie 89 pts. 10,903
• 8. steveB 87 pts. 10,893
• 9. dembones 85 pts. 10,882
• 10. mimi 84 pts. 10,829