Placeholder image of a protein
Icon representing a puzzle

1114: Unsolved De-novo Freestyle 53: Predicted Contacts

Closed since over 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
July 15, 2015
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1111, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1111 and use them as a starting point here.



Sequence:

MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH

Top groups

  1. Avatar for CHNO Junkies 21. CHNO Junkies 1 pt. 0
  2. Avatar for Window Group 22. Window Group 1 pt. 0
  1. Avatar for Mydogisa Toelicker 101. Mydogisa Toelicker Lv 1 8 pts. 9,776
  2. Avatar for Mr_Jolty 102. Mr_Jolty Lv 1 8 pts. 9,757
  3. Avatar for dahast.de 103. dahast.de Lv 1 8 pts. 9,754
  4. Avatar for phi16 104. phi16 Lv 1 8 pts. 9,751
  5. Avatar for Punktchen 105. Punktchen Lv 1 7 pts. 9,727
  6. Avatar for dettingen 106. dettingen Lv 1 7 pts. 9,706
  7. Avatar for Ashrai 107. Ashrai Lv 1 7 pts. 9,704
  8. Avatar for NexGenration 108. NexGenration Lv 1 7 pts. 9,690
  9. Avatar for ViJay7019 109. ViJay7019 Lv 1 6 pts. 9,683
  10. Avatar for hada 110. hada Lv 1 6 pts. 9,670

Comments