Placeholder image of a protein
Icon representing a puzzle

1114: Unsolved De-novo Freestyle 53: Predicted Contacts

Closed since over 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
July 15, 2015
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1111, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1111 and use them as a starting point here.



Sequence:

MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH

Top groups

  1. Avatar for CHNO Junkies 21. CHNO Junkies 1 pt. 0
  2. Avatar for Window Group 22. Window Group 1 pt. 0
  1. Avatar for proteansoup 111. proteansoup Lv 1 6 pts. 9,665
  2. Avatar for pizpot 112. pizpot Lv 1 6 pts. 9,632
  3. Avatar for SouperGenious 113. SouperGenious Lv 1 6 pts. 9,630
  4. Avatar for johngran 114. johngran Lv 1 5 pts. 9,621
  5. Avatar for Superphosphate 115. Superphosphate Lv 1 5 pts. 9,604
  6. Avatar for martinf 116. martinf Lv 1 5 pts. 9,602
  7. Avatar for harvardman 117. harvardman Lv 1 5 pts. 9,597
  8. Avatar for 01010011111 118. 01010011111 Lv 1 5 pts. 9,583
  9. Avatar for Ellis Shih 119. Ellis Shih Lv 1 5 pts. 9,574
  10. Avatar for Ernst Zundel 120. Ernst Zundel Lv 1 4 pts. 9,554

Comments