Placeholder image of a protein
Icon representing a puzzle

1114: Unsolved De-novo Freestyle 53: Predicted Contacts

Closed since over 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
July 15, 2015
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1111, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1111 and use them as a starting point here.



Sequence:

MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH

Top groups

  1. Avatar for CHNO Junkies 21. CHNO Junkies 1 pt. 0
  2. Avatar for Window Group 22. Window Group 1 pt. 0
  1. Avatar for jencimons 121. jencimons Lv 1 4 pts. 9,538
  2. Avatar for parsnip 122. parsnip Lv 1 4 pts. 9,535
  3. Avatar for Altercomp 123. Altercomp Lv 1 4 pts. 9,522
  4. Avatar for versat82 124. versat82 Lv 1 4 pts. 9,514
  5. Avatar for Deleted player 125. Deleted player pts. 9,490
  6. Avatar for landfrda 126. landfrda Lv 1 4 pts. 9,410
  7. Avatar for mirjamvandelft 127. mirjamvandelft Lv 1 4 pts. 9,405
  8. Avatar for smholst 128. smholst Lv 1 3 pts. 9,402
  9. Avatar for birkett83 129. birkett83 Lv 1 3 pts. 9,393
  10. Avatar for Duke_K 130. Duke_K Lv 1 3 pts. 9,337

Comments