Placeholder image of a protein
Icon representing a puzzle

1114: Unsolved De-novo Freestyle 53: Predicted Contacts

Closed since over 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary


Created
July 15, 2015
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1111, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1111 and use them as a starting point here.



Sequence:

MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH

Top groups


  1. Avatar for CHNO Junkies 21. CHNO Junkies 1 pt. 0
  2. Avatar for Window Group 22. Window Group 1 pt. 0

  1. Avatar for tela 131. tela Lv 1 3 pts. 9,336
  2. Avatar for abiogenesis 132. abiogenesis Lv 1 3 pts. 9,299
  3. Avatar for gurch 133. gurch Lv 1 3 pts. 9,297
  4. Avatar for karost 134. karost Lv 1 3 pts. 9,294
  5. Avatar for deLaCeiba 135. deLaCeiba Lv 1 3 pts. 9,286
  6. Avatar for Satina 136. Satina Lv 1 3 pts. 9,280
  7. Avatar for Arne Heessels 137. Arne Heessels Lv 1 2 pts. 9,253
  8. Avatar for Kevonni 138. Kevonni Lv 1 2 pts. 9,241
  9. Avatar for brgreening 139. brgreening Lv 1 2 pts. 9,215
  10. Avatar for Lindata 140. Lindata Lv 1 2 pts. 9,206

Comments