Placeholder image of a protein
Icon representing a puzzle

1114: Unsolved De-novo Freestyle 53: Predicted Contacts

Closed since over 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
July 15, 2015
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1111, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1111 and use them as a starting point here.



Sequence:

MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH

Top groups

  1. Avatar for CHNO Junkies 21. CHNO Junkies 1 pt. 0
  2. Avatar for Window Group 22. Window Group 1 pt. 0
  1. Avatar for reefyrob 141. reefyrob Lv 1 2 pts. 9,149
  2. Avatar for Jim Fraser 142. Jim Fraser Lv 1 2 pts. 9,134
  3. Avatar for bamh 143. bamh Lv 1 2 pts. 9,134
  4. Avatar for pfirth 144. pfirth Lv 1 2 pts. 9,062
  5. Avatar for nemo7731 145. nemo7731 Lv 1 2 pts. 9,018
  6. Avatar for Inkedhands 146. Inkedhands Lv 1 2 pts. 8,954
  7. Avatar for Jumbly 147. Jumbly Lv 1 2 pts. 8,933
  8. Avatar for Sunet 148. Sunet Lv 1 2 pts. 8,832
  9. Avatar for hahnhk 149. hahnhk Lv 1 2 pts. 8,827
  10. Avatar for AryehK 150. AryehK Lv 1 2 pts. 8,798

Comments