Placeholder image of a protein
Icon representing a puzzle

1114: Unsolved De-novo Freestyle 53: Predicted Contacts

Closed since over 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
July 15, 2015
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1111, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1111 and use them as a starting point here.



Sequence:

MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH

Top groups

  1. Avatar for CHNO Junkies 21. CHNO Junkies 1 pt. 0
  2. Avatar for Window Group 22. Window Group 1 pt. 0
  1. Avatar for Bierworst 151. Bierworst Lv 1 2 pts. 8,712
  2. Avatar for lacie 152. lacie Lv 1 1 pt. 8,694
  3. Avatar for trentis1 153. trentis1 Lv 1 1 pt. 8,682
  4. Avatar for cnhrcolemam 154. cnhrcolemam Lv 1 1 pt. 8,635
  5. Avatar for MaartenDesnouck 155. MaartenDesnouck Lv 1 1 pt. 8,580
  6. Avatar for FishKAA 156. FishKAA Lv 1 1 pt. 8,577
  7. Avatar for DodoBird 157. DodoBird Lv 1 1 pt. 8,544
  8. Avatar for lamoille 158. lamoille Lv 1 1 pt. 8,229
  9. Avatar for MoraX_the_Reaper 159. MoraX_the_Reaper Lv 1 1 pt. 8,090
  10. Avatar for maxionwimps 160. maxionwimps Lv 1 1 pt. 7,962

Comments