Placeholder image of a protein
Icon representing a puzzle

1114: Unsolved De-novo Freestyle 53: Predicted Contacts

Closed since over 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
July 15, 2015
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1111, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1111 and use them as a starting point here.



Sequence:

MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH

Top groups

  1. Avatar for CHNO Junkies 21. CHNO Junkies 1 pt. 0
  2. Avatar for Window Group 22. Window Group 1 pt. 0
  1. Avatar for ERKfoldit 161. ERKfoldit Lv 1 1 pt. 7,921
  2. Avatar for lrozmarin 162. lrozmarin Lv 1 1 pt. 7,902
  3. Avatar for inkycatz 163. inkycatz Lv 1 1 pt. 7,872
  4. Avatar for wanjiayu 164. wanjiayu Lv 1 1 pt. 7,829
  5. Avatar for momadoc 165. momadoc Lv 1 1 pt. 7,829
  6. Avatar for froggs554 166. froggs554 Lv 1 1 pt. 7,805
  7. Avatar for haroshin 167. haroshin Lv 1 1 pt. 7,734
  8. Avatar for bustchem 168. bustchem Lv 1 1 pt. 7,712
  9. Avatar for BetaPleatedSheetsRock 169. BetaPleatedSheetsRock Lv 1 1 pt. 7,693
  10. Avatar for daggersmith3 170. daggersmith3 Lv 1 1 pt. 7,673

Comments