Placeholder image of a protein
Icon representing a puzzle

1114: Unsolved De-novo Freestyle 53: Predicted Contacts

Closed since over 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
July 15, 2015
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1111, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1111 and use them as a starting point here.



Sequence:

MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH

Top groups

  1. Avatar for CHNO Junkies 21. CHNO Junkies 1 pt. 0
  2. Avatar for Window Group 22. Window Group 1 pt. 0
  1. Avatar for varjo1 171. varjo1 Lv 1 1 pt. 7,663
  2. Avatar for taminnugget 172. taminnugget Lv 1 1 pt. 7,648
  3. Avatar for leeshanay 173. leeshanay Lv 1 1 pt. 7,616
  4. Avatar for Alonso L. 174. Alonso L. Lv 1 1 pt. 7,599
  5. Avatar for Sydefecks 175. Sydefecks Lv 1 1 pt. 7,593
  6. Avatar for boondog 176. boondog Lv 1 1 pt. 7,568
  7. Avatar for FreeFolder 177. FreeFolder Lv 1 1 pt. 7,485
  8. Avatar for thalesdinmilet 178. thalesdinmilet Lv 1 1 pt. 7,448
  9. Avatar for ProteinPal 179. ProteinPal Lv 1 1 pt. 7,409
  10. Avatar for romanus 180. romanus Lv 1 1 pt. 7,208

Comments