Placeholder image of a protein
Icon representing a puzzle

1114: Unsolved De-novo Freestyle 53: Predicted Contacts

Closed since over 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary


Created
July 15, 2015
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1111, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1111 and use them as a starting point here.



Sequence:

MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH

Top groups


  1. Avatar for CHNO Junkies 21. CHNO Junkies 1 pt. 0
  2. Avatar for Window Group 22. Window Group 1 pt. 0

  1. Avatar for trinkulo 191. trinkulo Lv 1 1 pt. 6,746
  2. Avatar for sagan de castro 192. sagan de castro Lv 1 1 pt. 6,729
  3. Avatar for Kime1R 193. Kime1R Lv 1 1 pt. 6,722
  4. Avatar for ElsaTheNerdfighter 194. ElsaTheNerdfighter Lv 1 1 pt. 6,646
  5. Avatar for Echo.ControverC 195. Echo.ControverC Lv 1 1 pt. 6,601
  6. Avatar for Slipknotfruit 196. Slipknotfruit Lv 1 1 pt. 6,480
  7. Avatar for v4mp1r3 198. v4mp1r3 Lv 1 1 pt. 6,455
  8. Avatar for Contract 199. Contract Lv 1 1 pt. 6,367
  9. Avatar for GreekCivilization 200. GreekCivilization Lv 1 1 pt. 6,354

Comments