Placeholder image of a protein
Icon representing a puzzle

1114: Unsolved De-novo Freestyle 53: Predicted Contacts

Closed since over 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
July 15, 2015
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1111, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1111 and use them as a starting point here.



Sequence:

MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH

Top groups

  1. Avatar for CHNO Junkies 21. CHNO Junkies 1 pt. 0
  2. Avatar for Window Group 22. Window Group 1 pt. 0
  1. Avatar for puxatudo 201. puxatudo Lv 1 1 pt. 6,226
  2. Avatar for kuh0430 202. kuh0430 Lv 1 1 pt. 6,221
  3. Avatar for abnormallynormal 203. abnormallynormal Lv 1 1 pt. 6,056
  4. Avatar for milunka 204. milunka Lv 1 1 pt. 5,935
  5. Avatar for aspadistra 205. aspadistra Lv 1 1 pt. 5,895
  6. Avatar for cor2020 206. cor2020 Lv 1 1 pt. 5,848
  7. Avatar for Zac0118 207. Zac0118 Lv 1 1 pt. 5,793
  8. Avatar for perrystaff 208. perrystaff Lv 1 1 pt. 5,775
  9. Avatar for Yapock 209. Yapock Lv 1 1 pt. 5,675
  10. Avatar for TheChondrite 210. TheChondrite Lv 1 1 pt. 5,608

Comments